SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001612 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001612
Domain Number 1 Region: 67-179
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.74e-28
Family Arylsulfatase 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001612   Gene: ENSMMUG00000001209   Transcript: ENSMMUT00000001711
Sequence length 191
Comment pep:known_by_projection chromosome:MMUL_1:6:91780510:91828570:1 gene:ENSMMUG00000001209 transcript:ENSMMUT00000001711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQTASSGSCSLSLPCSARERTPEGGGWPGDRLSKPLPAMLMLWVSLVAVSALAVQAPGAG
EQRRGAAKVPNVVLVVSDSFDGRLTFHPGSQVVKLPFINFMKARGTSFLNAYTNSPICCP
SRAAMWSGLFTHLTESWNNFKGLDPNYTTWMDVMERHGYRTQKFGKLDYTSGHHSVRHSE
HGSTNQRSEKI
Download sequence
Identical sequences 9544.ENSMMUP00000001612 ENSMMUP00000001612 ENSMMUP00000001612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]