SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001634 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001634
Domain Number 1 Region: 218-246,594-775
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000311
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 2 Region: 252-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000553
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 73-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000362
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 118-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 26-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000572
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001634   Gene: ENSMMUG00000001220   Transcript: ENSMMUT00000001733
Sequence length 787
Comment pep:known_by_projection chromosome:MMUL_1:19:6787309:6826299:1 gene:ENSMMUG00000001220 transcript:ENSMMUT00000001733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFTGCCVMHSWERHTGPTLKPTTKDNKCRDSTMCPSHATCTSTVDSYYCACKQGFRSSNG
QNHFKDPGVECKDVDECSESQPCGPNSVCKNLSGRYECSCLHGFSSPTGNNWKPGKPGNF
SCTDINECLTGRVCPEHSDCVNSMGSYNCNCQVGFISRNSICKNIYHMTSPRRRGPWLGC
HFLVKHDSVFCKGKYDFVGSLTNLTPHPFYTDIDECTEMCLINSTCTNTPGSYFCTCHPG
FAPSNGQLNFTDQKVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGFRPDPESSQK
DGNFSCQRVPFKCKEDVIPDNEQVQQCQDRTTVKPEYATVSFCAQMNNIFSVLDNVCENK
TTVVSLKNTTESFVPVLKQISTWTKFTKEETSSLATVFLESVETLTLAAFLKPSANVTQT
VRTDYLDIESKVINKECSEENVNLSLAAKGDKMKIRCSTIEESESTGTTGVAFVSFVGVE
SVLNERFFQDHQAPLTTSKIKLKMNSRVVGGIMTGEKKDGFSDPVIYTLENIQPKQEFER
PICVSWSTDVKGGRWTSFGCVILEASEIHTVCSCNRMANLAVIMASGELTMDFSLYVISH
VGMIISLVCLVLAIATFLLCQSIRNHITYLHLHLCVCLLLAQILFLAGIDKTDNQTGCAI
IAGFLHYLFLACFFWMLVEAVMLFLMVRNLKVVNYFSSRNIKMLHICAFGYGLPVLVVVI
SASVQSQGYGMHNRCWLNTETGFIWSFLGPVCTVIAINSILLTWTLWILRQRLSSVNAEV
STLKDTR
Download sequence
Identical sequences 9544.ENSMMUP00000001634 ENSMMUP00000001634 ENSMMUP00000001634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]