SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001635 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001635
Domain Number 1 Region: 70-139
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.23e-20
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 2 Region: 699-768
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-18
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 305-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 757-826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.99e-18
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 5 Region: 641-710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 480-547
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 7 Region: 815-884
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 190-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.29e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 597-652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.42e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 989-1056
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.2e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 364-433
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.37e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 12 Region: 422-485
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000116
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 13 Region: 874-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 128-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000556
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 15 Region: 248-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 16 Region: 933-999
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 17 Region: 1047-1114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 18 Region: 9-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000639
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 1106-1148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000236
Family Complement control module/SCR domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001635   Gene: ENSMMUG00000001221   Transcript: ENSMMUT00000001734
Sequence length 1149
Comment pep:novel chromosome:MMUL_1:15:25786008:25792687:1 gene:ENSMMUG00000001221 transcript:ENSMMUT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCLEGFVLNTSAKIECMRGGQWNP
SPMSIQCIPVRCGEPPGIMNGYASGSNYSFGAMVAYSCNKGFYIKGEKKSTCEATGQWSS
PIPTCHPVSCGEPPKIENGFLENTTGRIFESEVSYQCNPGYKSIGSPVFVCQANRHWHSE
SPLMCIPLDCGKPPPIQNGFMKGEIFEVGSKVQFFCNEGYELVGDSSWTCQKSGKWDKKL
NPKCVPAKCPEPPLLENQLVLKELTTEVGVVTFSCKEGHVLQGPSVLKCLPSQQWNDSFP
VCKMVLCTPPPLISFGVPVPSSALHFGSTVKYSCVGGFFLRGNSTTLCQPDGTWSSPLPE
CIPVECPQPEEIANGIIDVQGLAYLSTALYTCKPGFELVGNTTTLCGENGHWLGGKPTCK
PIECLKPKEILNGKFSYTNLHYGQTVTYSCNRGFQLEGPSALTCLETGDWDVDAPSCNAI
HCDSPQPIENGFVEGADYSYGAMIIYSCFPGFQVAGHAMQTCEESGWSSSIPTCVPIDCG
LPPHIDFGDCTKVKDDQGYFEQEDDMMEVPYLTPQPPYQLGAVAKTLENTKESPATHSSN
FLYGTMVSYTCNPGYELLGNPVLICQEDGTWNGSAPSCISIDCDLPIAPENGFLRFTESS
MGSAVQYSCKPGHILVGSDLRLCLQNREWSGASPRCEAISCKKPNPIMNGSIKGSNYTYL
SMLYYECDPGYVLNGTERRICQDDKNWDEDEPICIPVDCGSPPVLANGQVRGDEYTFQKE
IEYTCNEGFLLEGARSQACLANGSWSGATPDCVPVRCATPPQLANGVMEGLDYGFMKEVA
FHCHEGYMLHGASKLTCQSDGNWDAEVPLCKPVNCGPPEDLAHGFPNGFSFIHGGHIQYQ
CFPGYKLHGNSSRRCLSNGSWSGSSPSCLPCRCSTPVIEYGTVNGTDFDCGKAARIQCFK
GFKLLGLSEITCEANGQWSSGFPHCEHTSCGSPPLIPNAFISESSSWKENVITYSCRSGY
VIQGSSDLICTEKGVWSQPYPVCEPLSCGPPPSVANAVATGEAHTYESKVQLRCLEGYTM
DTDIDTFTCQKDGRWFPDRISCSPKKCPLPENITHILVHGDDFSVNRQVSVSCAEGYTFE
GVNISVCQV
Download sequence
Identical sequences ENSMMUP00000001635 ENSMMUP00000001635 9544.ENSMMUP00000001635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]