SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001743 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001743
Domain Number 1 Region: 1212-1404,1449-1610
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-75
Family YicI catalytic domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 332-509,544-665
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.5e-71
Family YicI catalytic domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 88-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-51
Family YicI N-terminal domain-like 0.006
Further Details:      
 
Domain Number 4 Region: 977-1208
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-45
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 5 Region: 1613-1693
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-17
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 6 Region: 931-989
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000802
Family Trefoil 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001743
Domain Number - Region: 721-799
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000122
Family Putative glucosidase YicI, domain 3 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001743   Gene: ENSMMUG00000001302   Transcript: ENSMMUT00000001848
Sequence length 1832
Comment pep:known_by_projection chromosome:MMUL_1:2:122298293:122402802:1 gene:ENSMMUG00000001302 transcript:ENSMMUT00000001848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKFSGLEISLIALFVIVTIIAIALIVVLATKTPAVEEISDSTSTPTITPTITNPSDS
GKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQENT
TTSIGLEAKLNRIPSPTLFGNDINSVLLTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEF
TGPTVSDTLYDVKVTPNPFSIQVIRKSNDKILFDTSIGPLVYSDQYLQISTRLPSDYIYG
IGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYIFLGDTPEQVVQQYQQLVGLPAMPAYWSLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDLHNYGQ
KYVIILDPAISISRRANGATYASYERGNAQHVWINESDGSTPLIGEVWPGLTVYPDFTNP
NCIDWWANECSIFHQEVQYDGLWIDMNEVSSFIQGSTKGCNANKLNYPPFTPDILDKLMY
SKTICMDAVQNWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRGFILTRSTFAGSGRHAAH
WLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSR
NHNADGYEVSASCSPCSYGLKDCSIIYKGLLEVPFSSPIHILYILTFKKKGLIETNACTV
QYEFLDSNNQWLKNIYFFCGNTSNMLNCPLQKKQGADTVSAYIPDAVWYDYESGAKRPWR
KQRVDMYLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALDENNSAKGDFFWDD
GETKDTIQNGSYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDIVTEVTVAE
NNQSMSAHSNFTYDASNQVLLIADLNLNLGRNFRVQWNQIFSENETFNCYPDADLATEQK
CIQRGCVWKTDSSLSKAPECYFPRQNNSYSVTSTNYSSMGVTADLQLNTANARIKLPSDP
ISTLRVEVKYHKNDMLQFKIYDPQNKRYEVPVPLNIPNAPISTYENRLYDVEIKENPFGI
QIRRRSSGRVIWDSSLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWHTWGMF
TRDQPPGYKLNSYGFHPYYMALEEEGNAHSVLLLNSNAMDVTFQPTPALTYRTVGGILDF
YMFLGPTPEVSTKQYHEVIGHPVMPPYWALGFQLCRYGYANTSEIRELYDAMVAANIPYD
VQYTDIDYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETRTYPAFERG
QQNDVFVKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAEWW
AREIVDFYNEKMKFDGLWIDMNEPSSFVNGTTINQCRNDKLNYPPYFPELTKRTDGLHFR
TMCMETEQILSDGTSVLHYDVHNLYGWSQMKPTYDALQRTTGKRGIVISRSTYPTGGRWG
GHWLGDNYARWDNMDKSIIGMMEFSLFGISYTGADICGFFNNSDYHLCTRWMQLGAFYPY
SRNHNIANTRRQDPASWNETFAEMSKNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHE
FFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQIVNAYVPNARWFDYHTGEDIGVRGQFYTF
NASFETINLHVRGGHILPCQEPAQNTFYSRQKYMKLIVAADDNQTAQGSLFWDDGESIDT
YERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSIHVWGKRTPVNVVTLRYNGNQNS
LPFNEDNTKLILNIDLTQNNVTLEEPIEINWS
Download sequence
Identical sequences ENSMMUP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]