SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001787 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001787
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.6e-62
Family Alanine racemase-like, N-terminal domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 248-418
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.35e-32
Family Eukaryotic ODC-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001787   Gene: ENSMMUG00000001338   Transcript: ENSMMUT00000001893
Sequence length 450
Comment pep:known chromosome:MMUL_1:8:105341077:105377996:-1 gene:ENSMMUG00000001338 transcript:ENSMMUT00000001893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCKHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKATKYKEDEPLFTSSLWGPSC
DELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDA
GITSDSMMKNFFFVPSCIQLSQEDSFSAEA
Download sequence
Identical sequences ENSMMUP00000001787 9544.ENSMMUP00000032023 ENSMMUP00000001787 ENSMMUP00000032023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]