SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001788 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001788
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.6e-62
Family Alanine racemase-like, N-terminal domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.16e-34
Family Eukaryotic ODC-like 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001788   Gene: ENSMMUG00000001338   Transcript: ENSMMUT00000001894
Sequence length 448
Comment pep:known chromosome:MMUL_1:8:105341077:105377996:-1 gene:ENSMMUG00000001338 transcript:ENSMMUT00000001894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCKHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDSMMKNFFFVPSCIQLSQEDSFSAEA
Download sequence
Identical sequences A0A0D9RHN3 A0A2K5N6V8 A0A2K5WZB4 A0A2K5XFR7 A0A2K6AYI6 F7B9N8
ENSMMUP00000001788 NP_001247663.1.72884 NP_001278982.1.63531 NP_001288712.1.63531 XP_007999456.1.81039 XP_007999457.1.81039 XP_011729943.1.29376 XP_011729944.1.29376 XP_011729945.1.29376 XP_011729946.1.29376 XP_011838886.1.47321 XP_011838888.1.47321 XP_011838889.1.47321 XP_011917097.1.92194 XP_011917098.1.92194 XP_011917099.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]