SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001848 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001848
Domain Number 1 Region: 506-816
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-82
Family Protein kinases, catalytic subunit 0.000000255
Further Details:      
 
Domain Number 2 Region: 78-190
Classification Level Classification E-value
Superfamily L domain-like 3.13e-19
Family Ngr ectodomain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000016
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000762
Family I set domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001848   Gene: ENSMMUG00000001386   Transcript: ENSMMUT00000001961
Sequence length 831
Comment pep:known chromosome:MMUL_1:7:67490585:67874970:-1 gene:ENSMMUG00000001386 transcript:ENSMMUT00000001961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQNLTIRNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
KLNNQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPVDEVSPTPPITVTHKPEED
TFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGI
TTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGA
FGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCG
DGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMV
YLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDFCIWCEVGG
HTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRV
LERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Download sequence
Identical sequences F7D0S6
ENSMMUP00000001848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]