SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001850 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001850
Domain Number 1 Region: 514-810
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.01e-85
Family Protein kinases, catalytic subunit 0.000000216
Further Details:      
 
Domain Number 2 Region: 78-190
Classification Level Classification E-value
Superfamily L domain-like 3.06e-19
Family Ngr ectodomain-like 0.00035
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000016
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 321-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000889
Family I set domains 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001850   Gene: ENSMMUG00000001386   Transcript: ENSMMUT00000001963
Sequence length 825
Comment pep:known chromosome:MMUL_1:7:67490585:67874970:-1 gene:ENSMMUG00000001386 transcript:ENSMMUT00000001963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQNLTIRNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELRLEQNFFNCSCDIRWMQLWQEQGEA
KLNNQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPI
RWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRV
CPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Download sequence
Identical sequences A0A2I3MUE7 A0A2K5LT95 A0A2K5VL93 A0A2K6CET7 I2CY61
ENSMMUP00000001850 NP_001252566.1.72884 XP_011750628.1.29376 XP_011750629.1.29376 XP_011929810.1.92194 XP_011929811.1.92194 XP_015308832.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]