SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001901 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001901
Domain Number 1 Region: 34-186
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-34
Family C-type lectin domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001901   Gene: ENSMMUG00000001418   Transcript: ENSMMUT00000002015
Sequence length 186
Comment pep:novel chromosome:MMUL_1:11:9132128:9152835:1 gene:ENSMMUG00000001418 transcript:ENSMMUT00000002015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLMSVLLYQWIL
CQGSKYSTCASCPSCPDHWMKYGNHCYYFSVEKKDWISSLEFCLARDSHLLMITDKQEMS
LLQDFLSEAFHWVGLRNNSGWRWEDGSPLNFSRIYSNSLVQTCGAINKNSLQASSCEVSL
QWVCKK
Download sequence
Identical sequences G7N5X7 G7PJR4
ENSMMUP00000001901 ENSMMUP00000001901 9544.ENSMMUP00000001901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]