SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002019 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002019
Domain Number 1 Region: 16-108
Classification Level Classification E-value
Superfamily Immunoglobulin 9.38e-26
Family I set domains 0.0032
Further Details:      
 
Domain Number 2 Region: 110-206
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-24
Family I set domains 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002019   Gene: ENSMMUG00000029392   Transcript: ENSMMUT00000002138
Sequence length 206
Comment pep:known_by_projection scaffold:MMUL_1:1099214740003:292:2609:-1 gene:ENSMMUG00000029392 transcript:ENSMMUT00000002138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFFLDQRVRAHVGGQDKPFCSAWPSAVVPQGGHVTLWCHYRPGFNIFTLYKEDGVPVPEL
YKRIFWNSFLISPVTAAHAGTYRCRVFHPHSPTEWSAPSNPLVIMVTGLYEKPSLSAQPG
PTVPTGENMTLSCSSRRSFDMYHLSREGEAHELRLPAVPSVNGTFQADFPLGPATHGGNY
RCFGSLRDSPYEWSDPSDPLPVSVTG
Download sequence
Identical sequences G8F1M8
ENSMMUP00000002019 9544.ENSMMUP00000002019 ENSMMUP00000002019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]