SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002021 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002021
Domain Number 1 Region: 15-113
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-25
Family I set domains 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002021   Gene: ENSMMUG00000010125   Transcript: ENSMMUT00000002140
Sequence length 113
Comment pep:novel scaffold:MMUL_1:1099214727108:1776:4427:-1 gene:ENSMMUG00000010125 transcript:ENSMMUT00000002140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFFLVQRACPHTGVHRKPSLLALPGPLVKSGETVTLQCSSDMVFEHFFLHSEVNFEKPLH
LVGELHGGGSQANYSINSTTSDLAGTYRCYGSVTHSDYVLSAPSDPLDIVITG
Download sequence
Identical sequences ENSMMUP00000002021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]