SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002029 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002029
Domain Number 1 Region: 211-273
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.05e-19
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 154-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000157
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 3 Region: 90-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000105
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 30-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000862
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002029   Gene: ENSMMUG00000000243   Transcript: ENSMMUT00000002148
Sequence length 274
Comment pep:novel chromosome:MMUL_1:1:173533894:173563343:-1 gene:ENSMMUG00000000243 transcript:ENSMMUT00000002148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLPSMLLLFSVILISWVSTVGGEATLCDFPKIRHGFLYDEENYKPFSQVPIGEVFYYSC
EYNFVSPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGQIHLEGDTVQIVCN
AGYSLQNKEKSISCVERGWSAPPKCSFTKSTAYCGPPPSINNGDITSFPLSVYPPWSTVT
YRCQSFYELQGSVTVTCRNKQWSEPPRCLDPCVISEENMNKNNIQLRWRNNEKVYVKTGD
AVEFQCKFLYKAKISSPSFRAICQEGKFEYPICE
Download sequence
Identical sequences ENSMMUP00000002029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]