SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002040 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002040
Domain Number 1 Region: 343-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.61e-90
Family YicI catalytic domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 693-775
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.02e-22
Family Putative glucosidase YicI, domain 3 0.009
Further Details:      
 
Domain Number 3 Region: 70-160,211-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000232
Family YicI N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002040   Gene: ENSMMUG00000001532   Transcript: ENSMMUT00000002160
Sequence length 914
Comment pep:known chromosome:MMUL_1:7:20684885:20777596:1 gene:ENSMMUG00000001532 transcript:ENSMMUT00000002160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAEKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSAYQALLDSVTTDEDSTRFQ
IINEASKVTLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGN
LILADGKGGLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDEDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLSQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKKRFPNPER
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNAKRREPWLFGK
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVVP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSSADQRGHYPSKCVVEQILVLGLRKEPSFVTTHSSDGKDQPVAFTYCAKTSSLSLEK
LSLNIATDWEVRII
Download sequence
Identical sequences A0A2K5W0E6 H9EVN5
ENSMMUP00000002040 NP_001244608.1.72884 XP_005559352.1.63531 ENSMMUP00000033783 9544.ENSMMUP00000002040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]