SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002281 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002281
Domain Number 1 Region: 414-470
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.62e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000366
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002281   Gene: ENSMMUG00000030838   Transcript: ENSMMUT00000002411
Sequence length 470
Comment pep:known_by_projection chromosome:MMUL_1:13:48795683:48853885:1 gene:ENSMMUG00000030838 transcript:ENSMMUT00000002411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNSIQSPLFT
LQLPHSLHQTLQSATASLVIPAGRTLSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTV
SGHLYKVNVPIMVTQTSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPCSLQATTEKSQ
RIETVLQQPTVLPSGPVDRKHLENAASDILVSPGNEHKIVPEALLRHQESSQYVNLPGVV
FSPQVSQTNPNVESVLSGSASMTQNLHDESLSTSPHGALHQHVTDIQLHILKNGMYGCES
VKQPRNTEEPSNIPVSEKDSNSRVDLSIRVTDDDTGEIIQVDGTGDTSSNEETGSARDVD
ENEFLGVIDAGDLKVLEEEADSISNEDSATNSSDNEDPQVDIVEEDPLNSGDDVSEQDVP
DLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSMMUP00000002281 9544.ENSMMUP00000002281 ENSMMUP00000002281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]