SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002382 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002382
Domain Number 1 Region: 173-371
Classification Level Classification E-value
Superfamily E set domains 3.92e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000141
Further Details:      
 
Domain Number 2 Region: 71-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002382   Gene: ENSMMUG00000001792   Transcript: ENSMMUT00000002519
Sequence length 436
Comment pep:known chromosome:MMUL_1:19:54755295:54766616:1 gene:ENSMMUG00000001792 transcript:ENSMMUT00000002519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWVPARVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDEAEEGNGAETEDGA
ASPRVLTPTLALTLPL
Download sequence
Identical sequences A0A0A0MX50 A0A2K5I9H2 A0A2K5NFC6 A0A2K6ACS0 A0A2K6ARG9 A0A2K6QHK9 F7GGT0 G7PY21
ENSMMUP00000002382 9544.ENSMMUP00000002382 XP_010366961.1.97406 XP_011734456.1.29376 XP_011801850.1.43180 XP_011834761.1.47321 XP_011834762.1.47321 XP_011936126.1.92194 XP_014979951.1.72884 ENSMMUP00000002382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]