SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002459 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002459
Domain Number 1 Region: 153-297
Classification Level Classification E-value
Superfamily EF-hand 5.64e-52
Family Osteonectin 0.000000108
Further Details:      
 
Domain Number 2 Region: 95-150
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0000355
Further Details:      
 
Domain Number 3 Region: 70-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family Follistatin (FS) module N-terminal domain, FS-N 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002459   Gene: ENSMMUG00000001850   Transcript: ENSMMUT00000002604
Sequence length 299
Comment pep:known_by_projection chromosome:MMUL_1:6:148100559:148112881:-1 gene:ENSMMUG00000001850 transcript:ENSMMUT00000002604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGPE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQSECLS
Download sequence
Identical sequences 9544.ENSMMUP00000002459 ENSMMUP00000002459 ENSMMUP00000002459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]