SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002517 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002517
Domain Number 1 Region: 12-47,94-144
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.21e-22
Family Matrix metalloproteases, catalytic domain 0.0019
Further Details:      
 
Domain Number 2 Region: 190-278
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000023
Family I set domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002517   Gene: ENSMMUG00000001891   Transcript: ENSMMUT00000002665
Sequence length 279
Comment pep:known_by_projection chromosome:MMUL_1:1:4695722:4697206:1 gene:ENSMMUG00000001891 transcript:ENSMMUT00000002665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGDRPGSWRPL
LRSAVGCRGRALGQTAGGTFRGGGCYWSVWLTDLVHVAAHEIGHALGLMHSQHGRALMHL
NATLRGWKALSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYE
FPFPTVATTPPPPRTKTRLVPEGRNVTFRCGHKILHKKGKVYWYKDQEPLEFSYPGYLAL
GEAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG
Download sequence
Identical sequences ENSMMUP00000002517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]