SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002545 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002545
Domain Number 1 Region: 295-605
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 5.62e-41
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 707-876
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 89-211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1012-1058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002545
Domain Number - Region: 59-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002545   Gene: ENSMMUG00000001905   Transcript: ENSMMUT00000002693
Sequence length 1377
Comment pep:known_by_projection chromosome:MMUL_1:9:114739765:115576236:1 gene:ENSMMUG00000001905 transcript:ENSMMUT00000002693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGAPQPATPGLWRARPAGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSK
PCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTW
LIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVV
TTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVPSQVYCDCDKYWKG
EACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSP
SVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYDLESSIWNVGTLSRGPLQRYGHSLA
LYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMEL
DSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSI
YVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTH
NDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSS
VLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNIVRAKCPPKTA
ASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTS
CKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRINASRENYDNAKLYCYNLSG
NLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEP
NDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTS
NGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEPGCGWCN
DPSNTGRGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKSYEWSFIQCPACQCNGHSTC
INNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTACTCSGHANICHLHTGKCFCTTKG
IKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNK
NLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKNNIKEYRDSFSYEKFNFRSNPNI
TFYVYVSNFSWPIKIQIAFSQHNTIMDLVHFFVTFFSCFLSLLLVAAVVWKIKQTCWASR
RREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLTV
FLCLPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKNSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences ENSMMUP00000002545 ENSMMUP00000002545 9544.ENSMMUP00000002545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]