SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002667 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002667
Domain Number 1 Region: 724-750
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000733
Family Ran binding protein zinc finger-like 0.00042
Further Details:      
 
Domain Number 2 Region: 852-879
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000017
Family Ran binding protein zinc finger-like 0.0011
Further Details:      
 
Domain Number 3 Region: 660-685
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000118
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 4 Region: 795-821
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000458
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002667   Gene: ENSMMUG00000001993   Transcript: ENSMMUT00000002823
Sequence length 1474
Comment pep:known_by_projection chromosome:MMUL_1:4:17677533:17769382:-1 gene:ENSMMUG00000001993 transcript:ENSMMUT00000002823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFN
KNEDVCSCSTDTSEVPRWPENKEDHLIYADEESSNITDGRITPEPAVSNTEEPSTTSTAS
NYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDN
ISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLS
PSLGSSSVLKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQS
YGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQ
YPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDKKCSTGYEKNTTPGQNREQ
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKSPEEEEMEVPVLPKISLPIT
SSSLPTFNFSSPEITASSPSPINSSQSLTNKVQMTSPSSTGSPMFKFSSPIVKSTEADVL
PPSSIGFTFSVPVAKTAELSGSIGTLQPIISSSAHDVTAVNSTSCKKTPPEDCEGPFRPA
KILKEGSVLDILKSPGFASPKIDSVAAQPTTTSPVVYTRPAISSFSSSGIGFGESLKAGS
SWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSAPGTGFGDKFK
PVIGTWDCDTCLVQNKPEVIKCVACETPKPGTGVKRALTLTVVSESAETMTASSSSCTVT
AGTLGFGDKFKRPVGSWECSVCCVSNNAEDNKCVSCMSEKPGISVPTSSSSTVPISLPSG
GSLGLEKFKKPEGSWDCEVCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAAS
SSFKFGVPSPSSGPSQALTSTGNFKFGDQGGFKIGVSSDSGSVNPMSEGFKFSKPIGDFK
FGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKCSSA
GFSFGTGVINSTPAPANTIVTSENKSSFNFGTIETKSASVAPFTCKTSEAKKEEMPATKG
GFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQ
TKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNNSSSS
STPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKL
ATTSSTGTAVTPFVFGPGASSNNTATSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFG
ANQTPTFGQSQGASQPNPPGFGSISSSTALFSSGSQPAPPTFGTVSSSSQPPVFGQQPSQ
SAFGSGTTPNSSSVFQFGSSTTNFNFTNNNPSGVFTFGANSSTPAASAQPSGSGGFPFNQ
SPAAFTVGSNGKNVFSSGTSVSGRKIKTAVRRRK
Download sequence
Identical sequences ENSMMUP00000002667 ENSMMUP00000002667 9544.ENSMMUP00000002667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]