SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002669 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002669
Domain Number 1 Region: 682-708
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000706
Family Ran binding protein zinc finger-like 0.00042
Further Details:      
 
Domain Number 2 Region: 810-837
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000017
Family Ran binding protein zinc finger-like 0.0011
Further Details:      
 
Domain Number 3 Region: 618-643
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000115
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 4 Region: 753-779
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000445
Family Ran binding protein zinc finger-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002669   Gene: ENSMMUG00000001993   Transcript: ENSMMUT00000002825
Sequence length 1432
Comment pep:known_by_projection chromosome:MMUL_1:4:17677533:17769382:-1 gene:ENSMMUG00000001993 transcript:ENSMMUT00000002825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFN
KNEDVCSCSTDTSEVPRWPENKEDHLIYADEESSNITDGRITPEPAVSNTEEPSTTSTAS
NYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDN
ISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLS
PSLGSSSVLKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQS
YGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQ
YPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDKKCSTGYEKNTTPGQNREQ
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKSPEEEEMEVPVLPKISLPIT
SSSLPTFNFSSPEITASSPSPINSSQSLTNKVQMTSPSSTGSPMFKFSSPIVKSTEADVL
PPSSIGFTFSVPVAKTAELSGSIGTLQPIISSSGFASPKIDSVAAQPTTTSPVVYTRPAI
SSFSSSGIGFGESLKAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNK
SGKTTLSAPGTGFGDKFKPVIGTWDCDTCLVQNKPEVIKCVACETPKPGTGVKRALTLTV
VSESAETMTASSSSCTVTAGTLGFGDKFKRPVGSWECSVCCVSNNAEDNKCVSCMSEKPG
SSVPTSSSSTVPISLPSGGSLGLEKFKKPEGSWDCEVCLVQNKADSTKCLACESAKPGTK
SGFKGFDTSSSSSNSAASSSFKFGVPSPSSGPSQALTSTGNFKFGDQGGFKIGVSSDSGS
VNPMSEGFKFSKPIGDFKFGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGV
SNLGQEEKKEELPKCSSAGFSFGTGVINSTPAPANTIVTSENKSSFNFGTIETKSASVAP
FTCKTSEAKKEEMPATKGGFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKA
DNEEPKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTAD
QGAAKPVFSFLNNNSSSSSTPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGN
TAESSTSQSLLFSQDSKLATTSSTGTAVTPFVFGPGASSNNTATSGFGFGATTTSSSAGS
SFVFGTGPSAPSASPAFGANQTPTFGQSQGASQPNPPGFGSISSSTALFSSGSQPAPPTF
GTVSSSSQPPVFGQQPSQSAFGSGTTPNSSSVFQFGSSTTNFNFTNNNPSGVFTFGANSS
TPAASAQPSGSGGFPFNQSPAAFTVGSNGKNVFSSGTSVSGRKIKTAVRRRK
Download sequence
Identical sequences A0A1D5R5K2
ENSMMUP00000002669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]