SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002679
Domain Number 1 Region: 91-185
Classification Level Classification E-value
Superfamily Immunoglobulin 5.36e-19
Family I set domains 0.00000499
Further Details:      
 
Domain Number 2 Region: 20-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000293
Family V set domains (antibody variable domain-like) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002679   Gene: ENSMMUG00000001996   Transcript: ENSMMUT00000002835
Sequence length 260
Comment pep:known chromosome:MMUL_1:1:139612955:139632109:-1 gene:ENSMMUG00000001996 transcript:ENSMMUT00000002835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKAQADRKLLHLFILAILIPENNPVKLSCAYSGFSSPRVTSYEDRVTFLPSGITFKSV
TREDTGTYTCMVSEEGGNNYGEVKVKLIVLVPPSKPTVSIPSSATIGNRAVLTCSEKDGS
PPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYG
TPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILIFGIWFAYSRGHFDRTKKGTSSKKVI
YSQPSARSEGEFKQTSSFLV
Download sequence
Identical sequences ENSMMUP00000002679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]