SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002850 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002850
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 43-148
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 
Domain Number 3 Region: 415-530
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 4 Region: 185-283
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002850   Gene: ENSMMUG00000002138   Transcript: ENSMMUT00000003018
Sequence length 753
Comment pep:known chromosome:MMUL_1:13:74763125:74785699:-1 gene:ENSMMUG00000002138 transcript:ENSMMUT00000003018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTDPEKRAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHVLCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQS
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHS
FGLHGVACMGTEAHLSLCSLEFYRANDTARCPGGGPAVVSCVPGPLYAASSGQKKQQQSK
PQGEARVRLKSGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGA
RMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS
GGRSQHEGRVEVQIGGPGSLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSG
NITEVVMSGVRCTGTELSLDQCAHHGTHTTCKRTGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQIVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQII
Download sequence
Identical sequences XP_001110611.1.72884 XP_014968183.1.72884 9544.ENSMMUP00000002850 ENSMMUP00000002850 ENSMMUP00000002850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]