SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002886 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002886
Domain Number 1 Region: 376-507
Classification Level Classification E-value
Superfamily C-type lectin-like 6.18e-42
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 518-653
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 960-1111
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-34
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 5 Region: 827-953
Classification Level Classification E-value
Superfamily C-type lectin-like 4.56e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 661-811
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-29
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 7 Region: 1256-1396
Classification Level Classification E-value
Superfamily C-type lectin-like 5.67e-27
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 8 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.53e-26
Family Cysteine rich domain 0.0047
Further Details:      
 
Domain Number 9 Region: 1126-1252
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 10 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002886   Gene: ENSMMUG00000002167   Transcript: ENSMMUT00000003057
Sequence length 1479
Comment pep:known_by_projection chromosome:MMUL_1:16:58136593:58202498:1 gene:ENSMMUG00000002167 transcript:ENSMMUT00000003057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGRPASAPWSRHLLRCVLLLGGLHFGRPGAPGDAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSGQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQV
TYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWEGEYFWTALQDLNSTGSFRWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCPQGWASDPKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPRGGQSWRWSDGLGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSPQGRREWLRFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELEFLGHNLQKFSRAQEQHWWIGLHTSETDGRF
RWTDGSIINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTALPYICKRSNVTKETQ
PPDLPTTALGGCPSGWIQFLNKCFQVQGQDPQSRVKWSEAQFSCEQQEAQLVTITNPLEQ
AFITASLPNVTFDLWIGLHASQRDFQWVEQEPLMYANWAPGEPSGPSPAPSGNKPTSCAV
VLHSPSAHFTGRWDDRSCTEETHGFICQKGTDPSLSPSPAALPPAPGTELSYLNGTFRLL
QKPLRWHDALLLCESRNASLAYVPDPYTQAFLTQAARGLRTPLWIGLAGEEGSRRYSWVS
EEPLNYVGWQDGEPQQPGGCTYVDVDGAWHTTSCDTKLQGAVCGVSSGPPPPRRISYHGS
CPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQRAGGAVLSILDEMENVFVWEHLQS
YEGQSRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNVTMGVVCKLPRAEQSSFSPSALPENPAALVVVLMAVLLLLALLTAALILYRRRQ
SIERGAFEGARYSRSSSSPTEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences ENSMMUP00000002886 XP_001116053.1.72884 9544.ENSMMUP00000002886 ENSMMUP00000002886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]