SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002921 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002921
Domain Number 1 Region: 123-269
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-34
Family C-type lectin domain 0.000000204
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002921
Domain Number - Region: 24-109
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00196
Family HBL-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002921   Gene: ENSMMUG00000002191   Transcript: ENSMMUT00000003094
Sequence length 273
Comment pep:known chromosome:MMUL_1:11:10350936:10364470:-1 gene:ENSMMUG00000002191 transcript:ENSMMUT00000003094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFDDLKIQTMKDQPDEKSNGKKAKGLQFLYSPWWCLVAVTLAVLCLGLGVTIMVLGMQL
SQVSNLLKQQQTNLTHQKNKLEGQISARQQAEEASQESQNELKEMIETLAWKLNEKSKEQ
MELHHQNLNLQETLKRVANCSAPCPQDWIWHEENCYLFSTGSFNWEKSQEKCLSLDAKLL
KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRIRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Download sequence
Identical sequences F6WMD2
9544.ENSMMUP00000002921 ENSMMUP00000002921 ENSMMUP00000002921 NP_001181597.1.72884 XP_015006487.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]