SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002928 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002928
Domain Number 1 Region: 109-166
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000175
Family C-type lectin domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002928   Gene: ENSMMUG00000002192   Transcript: ENSMMUT00000003102
Sequence length 193
Comment pep:known chromosome:MMUL_1:11:10317494:10322540:-1 gene:ENSMMUG00000002192 transcript:ENSMMUT00000003102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYHPDLENLDEDGYTQLHFDSRSNTRIAVVSEKGSCVASPPWRLIAVILGILCLVILVI
AVVLGTMAIWRPNSGRNSLENGYFPSRNKENHSQPTQSPLEESVTPTKAVKTTGKGISIP
CPPNWIIYEKSCYLFSPSLNSWDQSKRQCSQLGSNLIKIDSSKELSLTLLPKLECNEAST
SQAQGILPPQPPE
Download sequence
Identical sequences ENSMMUP00000002928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]