SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003072 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003072
Domain Number 1 Region: 231-273
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000017
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003072
Domain Number - Region: 60-154
Classification Level Classification E-value
Superfamily STAT 0.000785
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003072   Gene: ENSMMUG00000002296   Transcript: ENSMMUT00000003253
Sequence length 274
Comment pep:known_by_projection chromosome:MMUL_1:8:15975445:16042367:-1 gene:ENSMMUG00000002296 transcript:ENSMMUT00000003253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHMSNMEKRIQHISDMEANLIDAEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNTID
EISKSLISLNTTLLDLQLNIEKLNGKIQEKTFKQQEEISKLEERVYNVSAEIMAMKEEQV
HLEQEIKGEVKVLNNITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRG
FPGPVGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLSTGPIWLNEV
YCFGRESSIEECKIRQWGTRTCSHSEDAGVTCTL
Download sequence
Identical sequences ENSMMUP00000003072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]