SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003086 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003086
Domain Number 1 Region: 43-116
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 6.54e-19
Family Ribosomal protein L11, C-terminal domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000000000000451
Family Ribosomal L11/L12e N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003086   Gene: ENSMMUG00000002309   Transcript: ENSMMUT00000003269
Sequence length 133
Comment pep:known chromosome:MMUL_1:19:57894205:57894702:1 gene:ENSMMUG00000002309 transcript:ENSMMUT00000003269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFNPNEIKVVYLRCTGGEVGATSALAPKIGPLGLLIEVVPSASALIIKALKEPPRDR
KKQKNIKHSGNITFDEIINIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDII
DDINSGAVECPAS
Download sequence
Identical sequences 9544.ENSMMUP00000003086 ENSMMUP00000003086 ENSMMUP00000003086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]