SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003183 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003183
Domain Number 1 Region: 238-301
Classification Level Classification E-value
Superfamily RILP dimerisation region 1.96e-17
Family RILP dimerisation region 0.0000296
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003183
Domain Number - Region: 78-123
Classification Level Classification E-value
Superfamily BLRF2-like 0.0353
Family BLRF2-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003183   Gene: ENSMMUG00000002377   Transcript: ENSMMUT00000003371
Sequence length 395
Comment pep:known_by_projection chromosome:MMUL_1:16:1446952:1450807:-1 gene:ENSMMUG00000002377 transcript:ENSMMUT00000003371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAVAPGWGSRETAGSGTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVRAL
ELLEQAAVGPAPDSLQVSAQQAEQELRRLREENERLRRELRAGPQEERTLLRQLKEVTDR
QRDELRAHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAVQIQLRAAQDRERERQQL
GEAATPPAKEGAQGQAGAPGHQHVQEPEWMTAGAGASEDPAEAAQQLGRPSEAGQCFSRE
EFEQILQERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKML
GTPEEAESSDDEDGSWLLLSDDKGDHPPPPESKIQSFFGLWYRGKAESPEDETDSPAPSK
LGGEEEAQPQSPAPDLPCSALHEHLCLGASATPEA
Download sequence
Identical sequences F7BU12
XP_001086142.1.72884 9544.ENSMMUP00000003183 ENSMMUP00000003183 ENSMMUP00000003183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]