SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003507 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003507
Domain Number 1 Region: 387-486
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003507   Gene: ENSMMUG00000002610   Transcript: ENSMMUT00000003713
Sequence length 487
Comment pep:known_by_projection chromosome:MMUL_1:13:125139176:125165225:1 gene:ENSMMUG00000002610 transcript:ENSMMUT00000003713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPKRRNGVNFSLAVVVIYLILLTAGAGLLVVQVLNLQERLRVLEMYLLNDTLSAEDSLP
FSLLRSTHSGERLAQAASRLQVLQSQLTWVRVSHEHLLQRVDNFTQNPGMFGIKGEQGPP
GLQGHKGAMGMPGAPGPPGPPAEKGAKGAAGRDGATGPPGPQGPPGVKGEAGLQGPQGAP
GKQGATGTPGPQGEKGSKGDGGLIGPKGETGTKGDKGDLGLPGEGRIGGVEGEQWVMGPP
GAQGSKGDSGRPGSPGLAGFPGAKGDPGQPGLQGVPGPPGAVGQPGAKGEPGSAGSRGLT
GLPGSPGSPGAAGLKGSKGDTGLQGQQGVKGEPGVPGPAGVKGEQGSPGLAGSKGAPGRA
GQKGDQGVKGSSGERGVKGEKGETGENAVSVRIVGSSNRGRAEVYYGGTWGTICDDEWHN
SDATVFCRMLGYSRGRALYKVGAGTGQIWLDNVQCRGTESTLWSCSKNSWGSHDCSHEED
AGVECSI
Download sequence
Identical sequences ENSMMUP00000003507 ENSMMUP00000003507 9544.ENSMMUP00000003507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]