SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003512 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003512
Domain Number 1 Region: 27-211,296-451
Classification Level Classification E-value
Superfamily L domain-like 1.09e-50
Family Ngr ectodomain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 503-669,750-864
Classification Level Classification E-value
Superfamily L domain-like 3.16e-50
Family Ngr ectodomain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1138-1326
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-27
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 979-1107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000832
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 909-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000366
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 1322-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003512
Domain Number - Region: 1413-1441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1365-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000552
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003512   Gene: ENSMMUG00000002614   Transcript: ENSMMUT00000003718
Sequence length 1522
Comment pep:known chromosome:MMUL_1:5:15037163:15403015:1 gene:ENSMMUG00000002614 transcript:ENSMMUT00000003718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGVGWQMLSLSLGLVLAILNTVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPE
LLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSAKFVCHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPT
NLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLY
GNKITELPKSLFEGLFSLQLLFSLLKGKNLKKFSPSPWRKIFFLSLYNNMLQTIANGIVS
PLRIHTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
SGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFT
VLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLE
SLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPF
NCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSR
CPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSN
NRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISAVPEGAFN
DLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFT
CQGPVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKVKEIDFCIQKLQREHS
HFAIARKTNILFSDSFLCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPP
EYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNKCK
NGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIVRINEPICQ
CLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQVRDLLETGFHRVSQDDLAL
ENYRKESREPLKGKNQPTFCFRCSVETINDGNFHIVELLALDQSLSLSVDGGSPKIITNL
SKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQT
GILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLP
INAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSC
DREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECT
DGSSFVDEVEKVVKCGCTRCAS
Download sequence
Identical sequences ENSMMUP00000003512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]