SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003694 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000003694
Domain Number - Region: 134-201
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.022
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003694   Gene: ENSMMUG00000002752   Transcript: ENSMMUT00000003910
Sequence length 533
Comment pep:known chromosome:MMUL_1:1:71219759:71238883:-1 gene:ENSMMUG00000002752 transcript:ENSMMUT00000003910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFRVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLF
DGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFS
YFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHP
HIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVH
SFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLN
NKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAP
QPEVRRYVLPLNIDKADTGKNLITLPNTTATAILCSDETIWLEPEVLFSGPRQQSFEFPQ
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALE
EDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS
Download sequence
Identical sequences ENSMMUP00000003694 ENSMMUP00000003694 9544.ENSMMUP00000003694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]