SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003736 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003736
Domain Number 1 Region: 137-248
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-30
Family C-type lectin domain 0.00000286
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003736
Domain Number - Region: 103-132
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00464
Family Triple coiled coil domain of C-type lectins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003736   Gene: ENSMMUG00000002786   Transcript: ENSMMUT00000003954
Sequence length 249
Comment pep:known chromosome:MMUL_1:9:57440824:57443922:-1 gene:ENSMMUG00000002786 transcript:ENSMMUT00000003954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLFPSFPVLLLSVVTASCSETKACEDAQKTCSVITCGIPVTNGTPGRDGRDGPKGEKGE
PGQGLRGLQGPPGKSGPPGNTGAPGIPGPRGQKGDHGDNSVAEAKLANLERQLQSLRSEL
DHMKKLQAFSLGKMSGKKLFVTNGERMPFSEVKALCAGLQATVAAPKNAEENKAIQDVAK
DTAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVILLSNGLWNDISCTAS
YIAVCEFPA
Download sequence
Identical sequences A0A2K5U7W5 A0A2K6E7M2 F7H263
9544.ENSMMUP00000003736 XP_001096399.1.72884 XP_005565366.1.63531 XP_011712912.1.29376 ENSMMUP00000003736 ENSMMUP00000003736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]