SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003755 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003755
Domain Number 1 Region: 100-309
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.88e-59
Family Endonuclease III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003755   Gene: ENSMMUG00000002807   Transcript: ENSMMUT00000003977
Sequence length 312
Comment pep:known_by_projection chromosome:MMUL_1:20:2029802:2038208:-1 gene:ENSMMUG00000002807 transcript:ENSMMUT00000003977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQESGMNSLSARMLTRNRSLGPRAGPRGCGEEPAPPRRGEAAAEARKSHSPVKRRRK
AQRLCVAYEGSDSEKGEKAEPLKVPVWEPQDWQQQLVNIRAMRSEKDAPVDHLGVEHCYD
SSAPPKVRRYQVLLSLMLSSQTKDQVTAGAMQRLRAQGLTVDSILQTDDATLGKLIYPVG
FWRSKVKYIKQTSTILQQRYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDT
HVHRIANRLRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVRPRCQAC
LNQALCPAAQGL
Download sequence
Identical sequences A0A2K6D920 F7H204
ENSMMUP00000003755 9544.ENSMMUP00000003755 ENSMMUP00000003755 XP_011746621.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]