SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003823 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003823
Domain Number 1 Region: 28-164
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-42
Family C-type lectin domain 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003823   Gene: ENSMMUG00000002858   Transcript: ENSMMUT00000004049
Sequence length 166
Comment pep:known_by_projection chromosome:MMUL_1:13:79482278:79484859:-1 gene:ENSMMUG00000002858 transcript:ENSMMUT00000004049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTNSCFMLISCLMFLSLSQGQETQTELPNARISCPEGTNAYRSYCYYFNEDPETWVDA
DLYCQNMNSGNLVSVLTEAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVS
YKSWDIGAPSSANAGYCASLTSCSGFKKWKDESCEKKFSFVCKFKN
Download sequence
Identical sequences A0A2K6CMC3
ENSMMUP00000003823 9544.ENSMMUP00000003823 ENSMMUP00000003823 NP_001181497.1.72884 XP_011712044.1.29376 XP_014968208.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]