SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003916 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003916
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.11e-71
Family Alanine racemase-like, N-terminal domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 208-369
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-34
Family Eukaryotic ODC-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003916   Gene: ENSMMUG00000002927   Transcript: ENSMMUT00000004151
Sequence length 370
Comment pep:novel chromosome:MMUL_1:1:34261151:34267308:1 gene:ENSMMUG00000002927 transcript:ENSMMUT00000004151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMLADLDMLASRHQAFCQALPQVSPFYAVKCNSSPWVLRVLAALGTGFDCASQVELEQVL
GLGVAPSRIIYANPCKPASHIRYAARHGVQLLTFDSEEELTKVAQHHPGARLLLRLRTQD
SQSTFPLSTKFGASLEACGHLLTSARDMGLAVVGASFHVGSNCQTPQSFTQAIADCRCVF
EMGRGAGHDMSCLDIGGGFPGTEDSGPKFEEMARVISAALAQDFPEERGVKVIAEPGRFY
MESVCTAAVNIIAKKAVLEPGIPRPWKRGGSRKLMYYLNDGHYGSFRLGHREPVPRVPIV
VKEFCSEPPLFPCTLYGPTCDASDRLFLEDVRLPELDVGDWLVFPSMGAYTSSMSCSFNG
FLPATICYTM
Download sequence
Identical sequences ENSMMUP00000003916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]