SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003947 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003947
Domain Number 1 Region: 109-226
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-28
Family C-type lectin domain 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003947
Domain Number - Region: 68-122
Classification Level Classification E-value
Superfamily t-snare proteins 0.0706
Family t-snare proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003947   Gene: ENSMMUG00000002954   Transcript: ENSMMUT00000004183
Sequence length 232
Comment pep:known_by_projection chromosome:MMUL_1:11:10202603:10210815:1 gene:ENSMMUG00000002954 transcript:ENSMMUT00000004183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEVTYATLTFQDYAGARNNRHGNNLRKKGHPAPSPIWRHAALGLLTLCLMLLIGLVTL
GMMFLQISNDINSDSEKLSQLQKTIHQRQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQ
EQMAVKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWTNSRKDCIDKNSTLV
KIDSLEEKDFLTSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY
Download sequence
Identical sequences A0A2K6CHB7
XP_011771089.1.29376 ENSMMUP00000003947 ENSMMUP00000040237 ENSMMUP00000003947 9544.ENSMMUP00000040237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]