SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003948 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003948
Domain Number 1 Region: 47-189
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-34
Family C-type lectin domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003948   Gene: ENSMMUG00000002955   Transcript: ENSMMUT00000004184
Sequence length 196
Comment pep:known_by_projection chromosome:MMUL_1:11:10182687:10205703:-1 gene:ENSMMUG00000002955 transcript:ENSMMUT00000004184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDEDGYVTLNIKTRKPALISAVMQHNYLQDENENRTGTLQQLAKRFCQYVIKQSELKGT
FKGHKCSPCDTNWRYYGDNCYGFFKHNLTWKESKQYCTDLNATLLKIDNHNILEYIKART
GLIRWVGLSRQKSNEVWKWEDGSVLSENMFELLEDGKGNMNCAYFHNGKMHPTFCENKHY
LMCERKAGMTKVDQLP
Download sequence
Identical sequences A0A2K5WEU2 A0A2K6AIZ6 A0A2K6E0U3
NP_001181682.1.72884 XP_005570158.1.63531 XP_011771091.1.29376 XP_011838720.1.47321 ENSMMUP00000003948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]