SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003951 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003951
Domain Number 1 Region: 100-253
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-28
Family C-type lectin domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003951   Gene: ENSMMUG00000002956   Transcript: ENSMMUT00000004187
Sequence length 265
Comment pep:known_by_projection chromosome:MMUL_1:11:10159848:10173043:1 gene:ENSMMUG00000002956 transcript:ENSMMUT00000004187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEVTYADLKFQNSSETEKIQEIAKFGEKAPPAPSCVWRPAALFLTVLCLLMLIGLGVL
GSMFHITLKTAMKKMNKLQNINEELQRNVSLQLMSNMNSSNKIRNLSTTLQTIATRLCRE
LYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVRTWQESRMACAAQNASLLKINNKNALEFI
KSRSTSYPYWLGLSPEKDYSYGTSVDDIINSSAWVTRNASDLNNMFCGYINRIYVHYDYC
IYRKKMICEKMANPVQLGFIHFREA
Download sequence
Identical sequences ENSMMUP00000003951 XP_015006546.1.72884 XP_015006547.1.72884 9544.ENSMMUP00000003951 ENSMMUP00000003951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]