SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004082 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004082
Domain Number 1 Region: 564-696,750-923
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.26e-81
Family Protein kinases, catalytic subunit 0.0000000000485
Further Details:      
 
Domain Number 2 Region: 212-309
Classification Level Classification E-value
Superfamily Immunoglobulin 7.83e-17
Family I set domains 0.058
Further Details:      
 
Domain Number 3 Region: 315-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000236
Family I set domains 0.046
Further Details:      
 
Domain Number 4 Region: 425-505
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000632
Family V set domains (antibody variable domain-like) 0.072
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004082
Domain Number - Region: 34-117
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0014
Family I set domains 0.08
Further Details:      
 
Domain Number - Region: 107-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0835
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004082   Gene: ENSMMUG00000003057   Transcript: ENSMMUT00000004330
Sequence length 976
Comment pep:known chromosome:MMUL_1:5:74655973:74744497:-1 gene:ENSMMUG00000003057 transcript:ENSMMUT00000004330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGARGAWDFLCVLLFLLHVQTGSSQPSVSPGEPSPPSIHPAKSELIVRVGNEIRLLCID
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSSSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTSYSLKGCQGKPLPKDLRFVPDPKAGITIKSVKRAYH
RLCLHCSADQEGKSVLSDKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNASIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNASGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAESALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSARIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Download sequence
Identical sequences F6V858
NP_001253024.1.72884 XP_005555330.1.63531 ENSMMUP00000004082 ENSMMUP00000004082 9544.ENSMMUP00000004082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]