SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004101 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004101
Domain Number 1 Region: 28-502
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.92e-90
Family L-arabinose binding protein-like 0.0000568
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004101
Domain Number - Region: 516-565
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000785
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004101   Gene: ENSMMUG00000003072   Transcript: ENSMMUT00000004349
Sequence length 928
Comment pep:known_by_projection chromosome:MMUL_1:4:147125788:147159499:1 gene:ENSMMUG00000003072 transcript:ENSMMUT00000004349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLIILITCFMIILATSQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDYPRRPQI
QKCVGFEISVFLQTLAMIHSIEMINNSTLLSGVKLGYEIYDTCTEVTVAMAATLRFLSKF
NCSKETVEFNCDYSSYMPRVKAVIGSGYSEITMAVSRMLNLQLMPQVGYESTAEILSDKI
RFPSFLRTVPSDFHQIKAMAHLIQKSGWNWIGIITTDDDYGRLALNTFIIQAEANNVCIA
FKEVLPAFLSDNTIEVRINQTLKKIILEAQVNVIVVFLRQFHVFDLFNKAIEMNINKMWI
ASDNWSTATKITTIPNVKKIGKVVGFTFRRGNISAFHSFLQNLHLLPSDSNKLLHEYAMH
LSACTYVKDTDLSQCIFNHSQRTLAYKANKAIERNFFMRNDFLRDYAEPGLIHSIQLAVF
ALGYAIRDLCQTRDCQNPNAFQPWELLGVLKNVTFTDGGNSFHFDAHGDLNTGYDVVLWK
EINGHMTVTKMAEYDLQNDVFIIPDQETKNEFRNLKQIQSKCSKECSPGQMKKTTRSQHI
CCYECENCPENHYSNQTDMPHCLLCNNETHWAPVRSTVCFEKEVEYLSWNDSLAILLLIL
SLLGIIFVLVVGIIFTRNLNTPVVKSAGGLRICYVILLCHFLNFASTSFFIGEPQDFTCK
TRQTLFGVSFTLCISCILTKSLKILLAFSFDPKLQKFLKCLYKPILIIFTCTSIQVVICT
LWLIFAAPTVEVNVSLPRVIILECEEGSILAFGTMLGYIAILAFICFIFAFKGRKLPENY
NEAKFITFGMLIYFIAWITFIPIYATTFGKYVPAVEIIVILISNYGILCCTFFPKCYVII
CKQDINTKSAFLKMIYSYSSHSVSSIAMSHASLDSMNSNVTMTNLSSSGKSATWQKSKDL
QAQAFAHTCRENATSVSKTLPRKRISSI
Download sequence
Identical sequences ENSMMUP00000004101 9544.ENSMMUP00000004101 ENSMMUP00000004101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]