SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004119 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004119
Domain Number 1 Region: 111-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000527
Family Cripto EGF-like domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 76-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004119   Gene: ENSMMUG00000003088   Transcript: ENSMMUT00000004368
Sequence length 186
Comment pep:known_by_projection chromosome:MMUL_1:2:89946395:89949611:-1 gene:ENSMMUG00000003088 transcript:ENSMMUT00000004368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCRKMARFSYSVIWIMAISKAFELGLVAGLSHREFARPSRGDLAFRDDSIRPQEEPAIRP
RSSQHVSPMGIQNSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHD
TWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTAFMLAGICL
SIQSYY
Download sequence
Identical sequences G7NY28
ENSMMUP00000004119 ENSMMUP00000004119 9544.ENSMMUP00000004119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]