SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004136 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004136
Domain Number 1 Region: 31-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000141
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 2 Region: 240-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000524
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 116-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000137
Family C1 set domains (antibody constant domain-like) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004136   Gene: ENSMMUG00000003101   Transcript: ENSMMUT00000004386
Sequence length 417
Comment pep:known chromosome:MMUL_1:19:51079088:51097468:1 gene:ENSMMUG00000003101 transcript:ENSMMUT00000004386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTMAAAWPPLLLALLVLSWPPPGTGDIVVQAPTQVPGFLGDSVTLPCYLQVPGMEETH
VSQLTWSRHGESGSMAIFHQTQGPNYSEPKRLEFVAARLGTELRDASLRMFGLRVEDEGN
YTCLFVAFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGKPVPVARCVSTGGRPPAHITWH
SDLGGMPNTSQAPGFLSGTVTVTSLWILVPSSQVDGKSVTCKVEHESFEKPQLLTVNLTV
YYPPEVSISGYDNNWYLSQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
PVDKPINTTFICNVTNALGARQAELTVQVKEGPPSEHSGMSSNIIIFLILGIVILLTLVG
IGLYFYRSRCSREFLWCHHLSPSSKEHASASANGYISYSDVSREASFSQDPQTEGTR
Download sequence
Identical sequences Q0MSE6
NP_001036851.1.72884 ENSMMUP00000004136 9544.ENSMMUP00000004136 ENSMMUP00000004136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]