SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004204 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004204
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 8.4e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000478
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004204   Gene: ENSMMUG00000003144   Transcript: ENSMMUT00000004455
Sequence length 391
Comment pep:known chromosome:MMUL_1:14:126970643:126973995:-1 gene:ENSMMUG00000003144 transcript:ENSMMUT00000004455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNASRWNVFETLIRVLTESMFKRLRKWVVTRFFGPSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSPNHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVVVNSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLIQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences F7EPG7
ENSMMUP00000004204 9544.ENSMMUP00000004204 ENSMMUP00000004204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]