SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004207 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004207
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 2.1e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.55e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004207   Gene: ENSMMUG00000003145   Transcript: ENSMMUT00000004458
Sequence length 419
Comment pep:known_by_projection chromosome:MMUL_1:14:127021886:127047589:1 gene:ENSMMUG00000003145 transcript:ENSMMUT00000004458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPWDPKRIPKQAREYVPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSQAQLHQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEDNEPKRLGGSREARGSV
Download sequence
Identical sequences F7EPF6
9544.ENSMMUP00000004207 XP_001113260.1.72884 ENSMMUP00000004207 ENSMMUP00000004207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]