SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004248 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004248
Domain Number 1 Region: 31-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004248   Gene: ENSMMUG00000028753   Transcript: ENSMMUT00000004502
Sequence length 82
Comment pep:known_by_projection chromosome:MMUL_1:19:50310299:50312709:1 gene:ENSMMUG00000028753 transcript:ENSMMUT00000004502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNTSSGFSGFCASPIEESHGALISSCNSRTMTDGLVTFRDVAIDFSQEEWECLDPAQRDL
YVDVMLENYSNLVSLGKVICLK
Download sequence
Identical sequences ENSMMUP00000004248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]