SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004272 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004272
Domain Number 1 Region: 78-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000015
Family I set domains 0.052
Further Details:      
 
Domain Number 2 Region: 170-258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00002
Family C1 set domains (antibody constant domain-like) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004272   Gene: ENSMMUG00000003199   Transcript: ENSMMUT00000004532
Sequence length 349
Comment pep:known chromosome:MMUL_1:2:32979805:33015548:-1 gene:ENSMMUG00000003199 transcript:ENSMMUT00000004532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPWRTANLGLLLILAVFLVAEAEGAAQSNNSLMLQTSKENHTLASNSLCMDEKQITQN
HSKVLAEVNISWPVQMARNAVLCCPPIEFRNLIVITWEIILRGQPSCTKSYRKETNETKE
TNCTDERITWVSTPDQNSDLQIYPVAITHDGYYRCIMATPDGNFHRGYHLQVLVTPEVTL
FESRNRTAVCKAVAGKPAAQISWIPAGDCAPTEHEYWGNGTVTVKSTCHWEGHNVSTVTC
HVSHLTGNKSLYIELLPVPGAKKSAKLYMPYVILTIIILTIVGFIWLLKISGCRKYNLNK
TESTSVVEEDEMQPYASYTEKNNPLYDTTNKVKASQALQSEVGTDLHTL
Download sequence
Identical sequences F7EF77
ENSMMUP00000004272 XP_001105494.1.72884 ENSMMUP00000004272 9544.ENSMMUP00000004272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]