SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004283 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004283
Domain Number 1 Region: 78-215
Classification Level Classification E-value
Superfamily L domain-like 2.24e-34
Family Ngr ectodomain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 358-421
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000249
Family Hormone receptor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004283
Domain Number - Region: 243-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0411
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004283   Gene: ENSMMUG00000003204   Transcript: ENSMMUT00000004544
Sequence length 1114
Comment pep:known chromosome:MMUL_1:8:38248147:38293229:1 gene:ENSMMUG00000003204 transcript:ENSMMUT00000004544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAPARLLLPLLLWLLLLLAPEARGSPGCPLPIRSCKCSGERPKGLSGGVPGPARRRVV
CGGGDLPEPPEPGLLPNGTVTLLLSNNKITGLRNGSFLGLSLLEKLDLRNNIISTVQPGA
FLGLGELKRLDLSNNRIGCLTSETFRGLPRLLRLNISGNIFSSLQPGVFDELPALKVVDL
GTEFLTCDCRLRWLLPWAQNRSLQLSERTLCAYPSALHAQALGSLQEAQLCCEGALELHT
HHLIPSLRQVVFQGDRLPFQCSASYLGNDTRIRWYHNRAPVEGDEQAGILLAESLIHDCT
FITSPLSPETARVELGNLWKADLNPAPGSLPKAPRSPASQAVVLRSLVHRQLPASAPRWP
RTLAGITAYQSCLQYPFTSVPLGGGAPGTRASRRCDRAGRWEPGDYSHCLYTNDITRVLY
TFVLMPINASNALTLAHQLRVYTAEAASFSDMMDVVYVAQMIQKFLGYVDQIKELVEVMV
DMASNLMLVDEHLLWLAQREDKACSRIICSISRGLRAQPALHCQHLGNELSAFPREVGGA
GAGLHPVVYPCTALLLLCLFATIITYILNHSSIRVSRKGWHMLLNLCFHMAMTSAVFAGG
ITLTNYQMVCQAVGITLHYSSLSTLLWMGVKARVFHKELTWRAPPPQEGDPALPAPSPML
RFYLIAGGIPLIICGITAAVNIHNYRDHSPYCWLVWRPSLGAFYIPVALILLITWIYFLC
AGLRLRGLLAQRPKGGNSRASLEAGEELRGSTRLRGSGPLLSDSGSLLATGSARVGTPGP
PEDGDSLYSPGVQLGALVTTHFLYLAMWACGALAVSQRWLPRVVCSCLYGAAASALGLFV
FTHHCARRRDVRASWRACCPPASPSAPHALPRALPAAAAEDGSPVFGEGPPSLKSSPSGS
SGHPLALGPCKLTNLQLAQSQVCEAGAAACGEEEPEAAGPRGSLGPRHPNNVHHGRRAHK
GRAKGHRAGEAGGKNRLKALRGGAAGAPELLSSESGSLHNSPTDSYLGSSRNSPGVGLQL
EGEPMLTPSEGSDTSAAPLSEAGRPGQRRSASRDSLKGGGALEKESKRRSYPLNAASLNG
VPKGGKYDDVTMMGAEVASGGCMKTGLWKSETTV
Download sequence
Identical sequences ENSMMUP00000004283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]