SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004326 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004326
Domain Number 1 Region: 13-163
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-42
Family C-type lectin domain 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004326   Gene: ENSMMUG00000003247   Transcript: ENSMMUT00000004592
Sequence length 173
Comment pep:known scaffold:MMUL_1:1099214750975:206:1011:1 gene:ENSMMUG00000003247 transcript:ENSMMUT00000004592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHSSLLLHVKQFVSDLRSLSCQMAALQGNGSERACCPVNWVEHERSCYWFSRSGKAWADA
DNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRP
EQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLL
Download sequence
Identical sequences 9544.ENSMMUP00000004326 ENSMMUP00000004326 ENSMMUP00000004326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]