SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004407 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004407
Domain Number 1 Region: 221-350
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.21e-24
Family Canonical RBD 0.000056
Further Details:      
 
Domain Number 2 Region: 345-386
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000106
Family Ran binding protein zinc finger-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004407   Gene: ENSMMUG00000003305   Transcript: ENSMMUT00000004673
Sequence length 592
Comment pep:known chromosome:MMUL_1:4:113413423:113415536:1 gene:ENSMMUG00000003305 transcript:ENSMMUT00000004673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSGSYSQSGGEQQSYSSYGNQGNQGYGQAPQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYGQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYNQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRPDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRIRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY
Download sequence
Identical sequences ENSMMUP00000004407 XP_014992622.1.72884 9544.ENSMMUP00000004407 ENSMMUP00000004407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]