SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004423 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004423
Domain Number 1 Region: 626-1150
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.35e-141
Family alpha-mannosidase, C-terminal domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 129-503
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.95e-132
Family alpha-mannosidase 0.00000000183
Further Details:      
 
Domain Number 3 Region: 506-618
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 5.89e-31
Family alpha-mannosidase, domain 2 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004423   Gene: ENSMMUG00000003316   Transcript: ENSMMUT00000004690
Sequence length 1151
Comment pep:known_by_projection chromosome:MMUL_1:6:106001716:106176344:1 gene:ENSMMUG00000003316 transcript:ENSMMUT00000004690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQRQLFMLQKITRIDYV
HIVLIMEANSMVRSVKDRIANCPESLSEEEKQSQSHFMSLIGDFLLGFSLSLKVENLTCL
EGDFIPLHNQNVVMLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHND
PGWLKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSL
IENGQLEIVTGGWVMPDEATAHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTM
AYLLNRAELSHMLIQRVHYAVKKHFAQHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIP
HTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSSRAQMLLDQYRKKSKLFRT
KVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADE
TQRDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFAL
RQAHKYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLE
KIIGTSAFFLILKDKLTYDSYSSDTFLEMDLKQKSQDSLPQKNIIRLSAEPKRVAYLVVY
NPLEQDRISVVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPL
GLKVYKILESASSNSHLADYVLYNNKVEDRGIFTIKNMINTEEGITLENSFVLLRFDQTG
LMKQMMTKEDGKHHEVSVQFSWYGTTIKRDKSGAYLFLPDGNAKSRLYTFPCFVWLVHNK
FYSNLLCFISHCFQKDRSSIAQGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFY
TDLNGYQIQPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSGQIEVI
MDRRLMQDDNRGLEQGVQDNKITANLFRILLEKRSAVNTEEEKNSVSYPSLLSHITSSFM
NHPVFPMTNKFSSPNLDLQGEFSPLQSSLPCDIHLVNLRTIQSKVGSGHSNEAALILHRK
GFDCRFSSKGTGLFCSTTQGKMLVQKLFNKFIVESLTLSSLSLMHSPPGTQNISEINLSP
MEISTYRIRLR
Download sequence
Identical sequences ENSMMUP00000004422 9544.ENSMMUP00000004423 ENSMMUP00000004423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]